DPCstruct | MC4732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 72 ± 3 aa |
| Standard deviation of domain lengths | 3.28 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448SZ73 | 67-135 | SRGSSKTPNTSEWPNAAVVCSLSQVLVRDSIPPRYYLSSIACAGILRRAEKRGRKLPPLLQTALERVVQ |
| A0A554XQI8 | 1-66 | MLNISVSPNAASVCFLWQVVEMTSIPQKYFLSAQACSGILVRAARRGKKLPALLNLVLTQQTDMQD |
| R7BID8 | 57-124 | None |
| A0A1Q6KPQ9 | 4-76 | None |
| D4KCC7 | 61-134 | None |
| A0A2J4JSK0 | 120-193 | None |
| A0A3R6TZH0 | 1-73 | None |
| A0A401LCG6 | 59-129 | None |
| A0A6M3XWS4 | 25-96 | None |
| A0A1I3XFX6 | 78-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.