DPCstruct | MC47314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 115 ± 12 aa |
| Standard deviation of domain lengths | 11.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H2RDN2 | 1-122 | MDAPEATARWNPAIYEEMEFRKGEVRNWRRTLQENFLERRVLKPEDMALFDYFFMRLERYNMSMEELKFSKIRKVAKLIAILPEEEK… |
| A0A177TZ75 | 4-97 | VRPVLAEIIQVKRWRHRVQKAFFGKAPPKDADMPAMAEIFQQVEAHQMSEEALKQSKLGKVMKKIAKTKDDYPQESKFRFKERAEEL… |
| A0A137QVQ6 | 9-105 | None |
| A0A166D723 | 1-126 | None |
| A0A0H2RMT0 | 27-142 | None |
| V2WGL5 | 203-313 | None |
| A0A4Y9YNE4 | 8-111 | None |
| A0A0D7A980 | 2-123 | None |
| A0A0F8X9J2 | 84-200 | None |
| A0A401H469 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.