DPCstruct | MC4731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 99 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2BVI3 | 79-179 | DAIFPSWNGPKWLDFALGYGANNMYGGFENRWEINDENIVLDPVLYGRHKQFVLALDYDLSAIKTKSPFLRTLLDGFNIFKLPAPAI… |
| A0A136PEU2 | 1-90 | MIVLPKSVTNTKFYPNFLAVALGMSIKDASHTAGSQRAKVEWILSLDWDVNQLPGNSDFMKKLKKILNFYHFPAPAVKISPEGVWYG… |
| A0A090W712 | 50-142 | None |
| A0A090VQV6 | 128-220 | None |
| A0A4P5USW8 | 142-239 | None |
| A0A0R2V405 | 1-108 | None |
| A0A3D6CEP7 | 34-135 | None |
| A0A365XZU7 | 133-233 | None |
| A0A3D3JJ41 | 245-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.