DPCstruct | MC47304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 91 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15535 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W2C5T1 | 511-586 | VPKYPGNDPVKVPAEGYEWRGNGVPGSKYGNWYNPNTKEWLRPDLNHPEPIAPHWDYGASNGKTYRIFPDGTFEVK |
| A0A7V8VGW4 | 1-98 | MLGLFGVGTNTILLWPRRGARWPGFPGSNPTKAPPGFEWRAKPGSTPGSREGNYYNPRTREVLRPDLSDPDPIGPHWDYIDPNMNRW… |
| A0A3B9J7X7 | 140-228 | None |
| A0A3M6PZ23 | 10-115 | None |
| A0A7C1PFI2 | 138-236 | None |
| A0A355KWN3 | 92-172 | None |
| D2MMS8 | 204-285 | None |
| A0A7C5ACW6 | 67-141 | None |
| A0A350XUQ4 | 1-78 | None |
| A0A2H5WYS4 | 165-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.