DPCstruct | MC473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M2A1X7 | 141-224 | FDVLTKDEIIEVKASAGALKVDQIEKYTNVNHKDFLNSENRKVIVYIEEPLINLAPEQLQKLNKIKDMGAIIVNSDEELRGVLK |
| A0A0A3IPF5 | 1-71 | MTQHQIIEFKKSMYAVKMDQIDKCINPSSSSFFNYEGRETVLYVDEIIDTSNPQTTKMNQELNSKGVTVVN |
| A0A6V8M484 | 85-169 | None |
| A0A7L4TG59 | 211-304 | None |
| L1P690 | 54-144 | None |
| A0A1X7M2D4 | 193-276 | None |
| A0A1R1DP03 | 13-96 | None |
| A0A7H8YV62 | 1-66 | None |
| A0A1M6NVV0 | 520-602 | None |
| A0A085ZX64 | 731-822 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.