DPCstruct | MC47298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 268 ± 40 aa |
| Standard deviation of domain lengths | 39.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0N9V3 | 78-289 | AVINWEDRKYVPGEKGVAEMCNIYCSSAGRGHVHYLKCDKETVSACVYTGLQDQRRHCMTELKPRPEHQVDELLHERYWKTIGWEDP… |
| G4U037 | 14-247 | AAITLDGRRFASGDSGAPMLCSLFCKSMGRHVHISPCRADIEDDGCREEGVEHIPSAPGTKQYDWITHRFKDPYTNTEQAEFDLCDR… |
| W2PG38 | 749-1042 | None |
| A0A1B7MR54 | 188-471 | None |
| A0A6G0S2C6 | 556-856 | None |
| A0A067CRK7 | 893-1137 | None |
| A0A7J7QQ68 | 3-254 | None |
| A0A820XUY7 | 15-252 | None |
| M4BB84 | 115-329 | None |
| W2Y2S5 | 441-736 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.