DPCstruct | MC47292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 113 ± 24 aa |
| Standard deviation of domain lengths | 23.52 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0MXC2 | 4-108 | RYKPELVKFMSYKDNVSYSKDHTFTTEALLRITPEDLCRWMNRQTYGDSEPSDEMRPIHRRLTTLEFTKKAISSFTPRINSAWDPLT… |
| K0RVC9 | 62-182 | MPRNKKYEPRLRELMQYVHRCEEPYEKGTTFTREQLLELKPEHIEGWLKMKAYGTDCPDIENGDRPIHARSSSLENSKKSVSFFMPN… |
| W2LP96 | 1-116 | None |
| W2LXU8 | 3-93 | None |
| A0A5J4Z1U2 | 1-139 | None |
| V9EFH5 | 1-93 | None |
| D0MW69 | 2-112 | None |
| A0A7S2VI60 | 29-162 | None |
| W2ZLQ1 | 1-79 | None |
| A0A2P4X4I6 | 3-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.