DPCstruct | MC4729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 215 ± 15 aa |
| Standard deviation of domain lengths | 14.56 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L0EZ92 | 53-290 | ITWVALRCAITCRSCGFLSPLAGIELDQGVDCAQCGSFQRFDKADWGGALSFAHAVGDLAGPEPEGRFPSADVWIGDQNPHRAVGET… |
| A0A136NXA8 | 2-211 | TGICIELKTSCGHCSSPLMLNAVTNDFICPACNKNNYFSDEDWQNLLDDAVKEGPGLNDGEGQPSTIMRGAYTYQLMYGKQQPRCGK… |
| A0A1G3QHB8 | 385-579 | None |
| A0A1V4MUY5 | 1-224 | None |
| A0A1V4MTY4 | 179-397 | None |
| A0A661NYD3 | 5-213 | None |
| A0A150PQC6 | 2-202 | None |
| A0A523QXT2 | 2-205 | None |
| A0A0Q1ASF8 | 2-215 | None |
| A0A0F6W7L9 | 103-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.