DPCstruct | MC47284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 155 ± 30 aa |
| Standard deviation of domain lengths | 29.77 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.17 |
| Pfam Score | 71.59 |
| Assigned Pfam label(s) | CL0198- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6AEB0 | 11-188 | QQPIFDSSSFLKVFRELKVSESHAYRVWRYLIQKNVKEFSDIPDIPKRILEEIQLNFKLLTSNIVQSHTTDDGNTTKLIIRLQDGHE… |
| A0A6B0Q8P5 | 2-148 | KPFIYDLTLEELQDWAKNNGEPAFRGGQIFDWLYVKRVNDFSEMTNLSKALREKLEEQFSFVTLSEITKLESKDGTVKFLFGLHDDH… |
| A0A5N6PSL3 | 249-415 | None |
| A0A2P2M8P3 | 91-272 | None |
| A0A7V4J2A9 | 2-157 | None |
| A0A7S9E0P1 | 2-115 | None |
| B7FLN5 | 1-176 | None |
| A0A7Y5JKX0 | 197-361 | None |
| A0A2Z6MEP5 | 17-181 | None |
| A0A2G6EQR1 | 2-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.