DPCstruct | MC47283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 236 ± 42 aa |
| Standard deviation of domain lengths | 42.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6AAY9 | 55-277 | NNPTSNIGGENSINPLEWLLRSLSLLNLPRNPQYYDFSHLSESELIELKRKVKKQLREFDITYQKKYGQLPKKNDKESLRPLYIYYR… |
| A0A1R2AUD1 | 48-208 | EGKQKLEQSLRKLKLDYTATNGRDLGNKSYEDLVAEKKKVKNELKNYDNNFKNLFGRVPKREEKEPMRPLYVYYKKLKLSLSRRANE… |
| A0A3B5R0C5 | 209-422 | None |
| A0A131XCE2 | 637-910 | None |
| A0A1I8GI29 | 1-198 | None |
| A0A4P9WI43 | 216-455 | None |
| A0A2R5GUT2 | 501-695 | None |
| A0A183LX29 | 99-398 | None |
| U6L068 | 437-724 | None |
| A0A1A9ZYH6 | 517-756 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.