DPCstruct | MC47280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.79 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 53.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7WMD0 | 6-66 | KYGWRIDLRATENHWPGWFQGLSKLFLSCSAQKLLLLASLDRLDTDLTVAQMQGRFEVHAF |
| M2WXK1 | 291-357 | NEDEKCYSWRTNLEESECYWKSWFENLSPTFLKIAVPKLLILAGQDRLDKPLTIAQMQGQFQLSVVR |
| A0A0N0NPV0 | 49-121 | None |
| A0A0B2US84 | 482-541 | None |
| A0A261XXN0 | 153-209 | None |
| X6MMG7 | 133-198 | None |
| A0A7R9TA11 | 195-253 | None |
| A0A0N1I719 | 1-69 | None |
| A0A4T0IZP0 | 503-562 | None |
| A0A5E3XIV0 | 615-681 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.