DPCstruct | MC4728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 184 ± 13 aa |
| Standard deviation of domain lengths | 13.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.84 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A136NJJ6 | 1-201 | MCQSGKPGDGEGKKPGSGLQQLLQQLQQMIAKQQQLNNQMQGMNPNGNQGKLSQEQMAQMQRLALEQQQIKDGVNQLNEEFKKQQEA… |
| A0A7Y3ED51 | 134-310 | GGSSSPSAEEVQQQLEQLAQEQADVNNQASQMMPMQLTPQAQQQQMEQLADQQQQVASDVGQMSNQEGEDGALGDLEALAQEAEALA… |
| A0A350PHQ8 | 139-330 | None |
| A0A660XMZ9 | 62-244 | None |
| A0A661TZ28 | 148-323 | None |
| A0A7Y2E6L5 | 242-429 | None |
| A0A3M1LVZ0 | 28-227 | None |
| A0A800EQE6 | 294-478 | None |
| A0A660YUN0 | 1-155 | None |
| A0A3D3JGE5 | 196-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.