DPCstruct | MC4727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432G5J9 | 4-86 | SYYKTIQGVRYDRALLEAAEERIYGQGDGRISKKDAEEIVELSKDGGRITETELRTLKYISENYHFTPKAAAWFAGKLPDIEQ |
| A0A7S2X8I3 | 140-220 | KKKSLYQIIDKKKYDRGMLDEAKKSETIGMKEAEAILDEALDGNVYTNTEQSTWSYIKDNHKFDSGVKEYLEERLEDFLKH |
| A0A5E8A1G3 | 133-214 | None |
| A0A7S4SAC2 | 39-131 | None |
| A0A2D5UGS2 | 2-86 | None |
| R1BZI2 | 27-114 | None |
| N1U4W0 | 13-104 | None |
| A0A812H9X0 | 20-108 | None |
| A0A1G3QCZ8 | 2-86 | None |
| A0A812K0H0 | 3-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.