DPCstruct | MC4726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 99 ± 4 aa |
| Standard deviation of domain lengths | 4.37 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0N9Z7 | 4-101 | SHEGLSGITKDNYAGIPEELKEFNYYYNDMETGHVIMAIPECLLSEAEDNGDLDMYECPFPCRYVLEKGYRMHKGHVICDGEYDMSL… |
| A0A2A4TAM7 | 1-101 | MDPETFVLSTFRNLLVPDKEYITPLPPELQKWYCYMQTTGHIILCVLKDDYVEERDLRNHLIPIPVKSALRHYKVKRGHIVVDLDYS… |
| A0A174NZV8 | 164-262 | None |
| A0A3D9LKD1 | 4-109 | None |
| A0A1C4RKQ7 | 303-399 | None |
| A0A3P3TAE2 | 218-313 | None |
| A0A6I5BF69 | 70-163 | None |
| A0A0M4DLZ3 | 96-204 | None |
| A0A101UAQ8 | 258-355 | None |
| A0A7C4EWX6 | 177-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.