DPCstruct | MC47250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 155 ± 19 aa |
| Standard deviation of domain lengths | 19.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2K0L7 | 250-379 | NVLRIGSVGLDVIMSNVAGHMNKEGLARNGSDVNGIAYVTEVFVEVQWLWLILPIILVVSGTIFIVIVIIENRKNGTNLWKSSVLAF… |
| W6YLR8 | 1-178 | MYFLKDQFDKKSLVLAYGPQSPSASYGELWTKNLYRNGTANLDSVEAFTARLTRSMSASIRLFGSKRSEKFGFVQGDAVQTDTCVQV… |
| A0A7C8MJQ4 | 12-147 | None |
| A0A6A5XCK6 | 75-224 | None |
| A0A6A6YVL1 | 6-167 | None |
| A0A6A7ACW8 | 161-351 | None |
| A0A4S9N001 | 53-189 | None |
| A0A7D5YNV8 | 74-266 | None |
| A0A1V6R223 | 190-332 | None |
| A0A439CY68 | 75-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.