DPCstruct | MC47245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 139 ± 18 aa |
| Standard deviation of domain lengths | 17.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1GI79 | 6-136 | VKKDKAFRRYESNVDRALALFDTPQQEWADYISFLGRLLKAIQTHPQDVPIIPHSATVATRLAQCLNPSLPSGVHQKTLEVYAYVFS… |
| A0A183HHD2 | 15-152 | AAQAASLISNSKYRAYVAAVDKALKAFETTNEWADLISALAKLSRVFHANAKFGDIPKPVTVAKRLSQCLHPALPHGVHLKALETYR… |
| A0A0V0QCA7 | 2-156 | None |
| L5KAZ5 | 202-330 | None |
| A0A0V0ZUS2 | 21-166 | None |
| A0A0R3TSQ4 | 1-135 | None |
| A0A3B3QI80 | 2-106 | None |
| A0A7J7IRD2 | 20-157 | None |
| A0A5S6PSF9 | 15-152 | None |
| A0A175VU61 | 31-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.