DPCstruct | MC47242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 382 ± 86 aa |
| Standard deviation of domain lengths | 85.71 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 71.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.38 |
| Mean intra-cluster sequence similarity (%) | 12.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0202- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1G4G8 | 12-381 | LDHSNHIGGVECISDGLNVTFTTIAAFQHARNNWASNTTFVAITANVTCGSAPAGQHTFWQVTGANFANSSLSAQLEASETSIDKVV… |
| A0A4S9KWC8 | 328-585 | PVEYPFDSTYSLKMPSFKGGYVYKDATSTLVCNDCGMTVSKLEIKGTIVVDLQSATILSSTMTLNQDSVQRFNMDIYTTGPATGSWS… |
| A0A0C9LMV7 | 226-758 | None |
| A0A0C9LNC6 | 205-753 | None |
| A0A177WFR9 | 35-330 | None |
| A0A0S6XNK0 | 172-822 | None |
| A0A6G1IFN7 | 24-340 | None |
| A0A1Y2HXE6 | 101-463 | None |
| A0A7C2JTG5 | 264-543 | None |
| A0A7S2BUE6 | 13-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.