DPCstruct | MC47238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 142 ± 31 aa |
| Standard deviation of domain lengths | 30.54 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1ERL8 | 11-157 | GSWQASFRVAVAASNGYNRYQNIPDKALPNFTGPVSIGNAAIQDGSYYQYIDHNDQSAFDPAICAADCQENTAYNKLHSGGGSYTAC… |
| A0A6A6GG46 | 12-129 | LYIISGSARAPRGYTWEYAGFYASLNQDGYIGMLNLATYNVTECSAQCDSITGCKGFSIYYERSPTQNPASECPNPSMQTTIRCTFY… |
| A0A137QYT3 | 12-127 | None |
| A0A2H3C3U6 | 3-103 | None |
| A0A194USG0 | 358-480 | None |
| R9PD35 | 657-811 | None |
| A0A6G1J0P3 | 1-200 | None |
| A0A6G1J0E4 | 26-195 | None |
| A0A6A5UKR0 | 1-122 | None |
| A0A4S9M3K0 | 6-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.