DPCstruct | MC47237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 284 ± 34 aa |
| Standard deviation of domain lengths | 33.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3P1Z9 | 85-310 | WFFIATEVPVITACIGPLANMISVAALVNRWRAGGEHNQDILDTPTVLSLNAISLALGCIANVSLILNFSQRLNYKVSQLLSVVCFM… |
| R1EF00 | 1-277 | MNDPGIDEPISNATQDLEQTPYNSVQKEEEEEEQDFLDPSRWWFASTACPLIAGTFGPLANAFSICALVVKWRVEIPPGMDETAGTP… |
| A0A1Y2ENL6 | 54-380 | None |
| A0A427YKI4 | 30-288 | None |
| A0A1Y1Y3L6 | 9-316 | None |
| I2H144 | 60-291 | None |
| A0A1E3PUZ1 | 2-268 | None |
| A0A165UEC1 | 109-372 | None |
| A0A316UVG4 | 83-401 | None |
| U5HC51 | 11-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.