DPCstruct | MC47236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 93 ± 18 aa |
| Standard deviation of domain lengths | 17.99 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.70 |
| Pfam Score | 58.19 |
| Assigned Pfam label(s) | CL0010- PF01159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B9SY53 | 4-87 | FICEPGRIVLCKAGRESGRYFLVTALEGADLLLVDGKHRLMQNPKRKNPLHVQATAQTIPLSGLTDKAIRKILNPLNETVNRPQ |
| A0A348P3W1 | 2-72 | GKGAVAVSLRGKDKDSILCVVAVDEKGVWVCDGRKRRLENPKLKNPKHLKALDRALSEEQMRTDKQLRKAL |
| A0A497SQL9 | 1-106 | None |
| A0A662QSK9 | 6-70 | None |
| A0A842Q5F2 | 3-106 | None |
| A0A7C1ZZV7 | 1-68 | None |
| A0A0B2P5Y1 | 120-216 | None |
| A0A510DVE1 | 10-90 | None |
| A0A7X7S851 | 2-87 | None |
| A0A2G2WV77 | 61-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.