DPCstruct | MC47231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 216 ± 26 aa |
| Standard deviation of domain lengths | 26.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 48.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12576 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0JT61 | 73-302 | LFALFDPVHGAQKLQQQNFSTEEVDTLEQNFLTYFFQVMQKSNFNILSDDEVELAHSGQYLLNLPIKVDETKLDNKLLSKYFKEHHH… |
| A0A1D6G502 | 69-281 | MELFALFDPVHGAKKLEQQNFLPEEIDTLEQNFLSYFFRVMEKSNFNIVNDDEVELAHSGQYLLNLPIKVDESKLDDKLLSKYFKEH… |
| A0A6N2MA62 | 61-247 | None |
| A0A7J6DN54 | 79-289 | None |
| A0A1D6G501 | 6-215 | None |
| A0A7S0YI09 | 101-276 | None |
| A0A6A6N9V0 | 425-636 | None |
| A0A287MF34 | 2-216 | None |
| K7MHF3 | 2-207 | None |
| A0A1D1ZYC4 | 9-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.