DPCstruct | MC4723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 126 ± 8 aa |
| Standard deviation of domain lengths | 7.76 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815X1F7 | 1-116 | MALFSAETSGRCVVKGTDIPPPPEPEPITITELPLPPVTSNDAEGGCTFDVNPHGTGCIGQALTAFQSGAFLPDGLHVTVTVNFTGA… |
| A0A428NJ82 | 1-123 | MKLIFSSLLLYGTAVASVIPRDQSAIPPPPKPEPISLKTLLLPPAIADDAPVGGCDKKANPRGTGCLGRTTYFQGGSFSPDGNHVYA… |
| A0A2X3KZG2 | 19-155 | None |
| A0A4Q7K7K0 | 2-123 | None |
| A0A428PGP9 | 1-126 | None |
| X0I2U9 | 1-129 | None |
| A0A830IMJ2 | 1-141 | None |
| W9JDJ7 | 3-120 | None |
| W3X136 | 6-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.