DPCstruct | MC47227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 233 ± 18 aa |
| Standard deviation of domain lengths | 17.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6FS76 | 46-278 | SEDRSLHQTPEGSLLDIMRNAHDLLSSCGIDIPMVQDNSEYMHSGPPFLIFLHPALGPFWDIIRQKFVGGSVSKGSELQIEVAEFLW… |
| F8KVK8 | 497-754 | FDHRLEPKDYHVLKTYLTYHERLKTISVTKHSLCPNGSLAETPEKCFYDLMQNMHALLSQKCHLEMPAMPSEEEYQKQGPSFIALFH… |
| C1E5I4 | 150-422 | None |
| A0A4D9BEG4 | 51-283 | None |
| A0A835EWU2 | 638-872 | None |
| A0A1F8J2K4 | 458-662 | None |
| A0A0A9TRM4 | 1-217 | None |
| A0A835V8U8 | 3-226 | None |
| A0A2K1YWC0 | 315-548 | None |
| A0A3D2Q4S6 | 47-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.