DPCstruct | MC47226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 178 ± 13 aa |
| Standard deviation of domain lengths | 12.71 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 58.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6FQE1 | 1-177 | MRLQRHKMGVDDFELLTIIGRGAFGEVSKETIIDSQLAQQKDYTLKKPSAYHYNILVLGFVVLLYGLLGIPPSNGVLPQSPMHTKSL… |
| A0A5N5HBC9 | 769-943 | KDMGKVSPAYVFAAIIPAVMVAGLYFFDHSVASQMAQQHEFNLKKPSAYHYDILLLGFMTLLCGLLGLPPSNGVLPQSPMHTKSLAV… |
| A0A452Y4Q3 | 63-243 | None |
| B9FMR5 | 130-303 | None |
| A0A0B0PF00 | 25-205 | None |
| A0A803NCJ0 | 1-165 | None |
| A0A835QWI7 | 284-464 | None |
| A0A287EZ33 | 1-174 | None |
| A0A444CHJ7 | 58-268 | None |
| A0A2P5CV65 | 2-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.