DPCstruct | MC47223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 5.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H1L9Z7 | 11-76 | KGIPNEPALLAAAAENPGGSVAEIDPTYIDDPNGYVPPAIRGAWLVDSSGKLTGEYQENLRHGVPR |
| A0A354U1Y1 | 1-61 | MTSPLPGEIEAAKSNPSGWVYRVAGTFSSTDAIPPEAIVGAWKVNDRGAIVGEFVANSKYD |
| A0A161JIQ0 | 1-57 | None |
| A0A1Q4Y7Y6 | 146-210 | None |
| S3AT75 | 180-251 | None |
| E6V492 | 29-99 | None |
| W7J2G4 | 565-636 | None |
| A0A0H5CSK2 | 184-255 | None |
| A0A1V2QK31 | 585-656 | None |
| A0A1I6DTV5 | 3-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.