DPCstruct | MC47215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 16 aa |
| Standard deviation of domain lengths | 15.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.51 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF00347- PF06212 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A093Y721 | 1-131 | MSCAASQRCLVQLLREPIRSKSVPAFLVPALSQPLRTQCFSTTSAARSRIGGASVSIPPEVNLSLIDLPQTNVRGKAKDAPKMAVEV… |
| A0A167YJE4 | 2-100 | TIAQRPWFSASAKLSSKLGRTPISLPPGVELSMSDLKTAKSTTSYKNMVKRTITVKGPLGTLELDVPEFVDLQQNAEDRTVLLSVRD… |
| M9LJY8 | 149-289 | None |
| A0A804LKH4 | 1-114 | None |
| A0A817B6X1 | 143-261 | None |
| C4JGZ7 | 1-132 | None |
| A0A421JAI7 | 4-106 | None |
| L0PFP9 | 115-222 | None |
| A0A444EMR0 | 54-163 | None |
| G2QHA9 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.