DPCstruct | MC47212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 217 ± 52 aa |
| Standard deviation of domain lengths | 51.76 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01774 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A411YEP9 | 15-180 | DPPLVLRPTPEAVHLVGGTAGPLGGDDLALDVEVGPGARLTVRTVAASLVYPGTGPSRLAVTARVDRGGHLDWAPEPTVAIAGCDHE… |
| A0A0P1H578 | 4-199 | VQLNTAGGITGGDHLMFAAQAEEQSHLRLTTQAAERIYRSVDGRPGTVETSLTVAAGARLDWLPQETILFDHSSLRRSMRVDLAHDA… |
| R7WT45 | 3-136 | None |
| A0A066YM39 | 6-153 | None |
| K0TPQ0 | 43-344 | None |
| T2REW7 | 14-166 | None |
| A0A146H7Z2 | 32-260 | None |
| A0A161HYL8 | 26-213 | None |
| K8E8S8 | 264-520 | None |
| A0A4Q7L4W2 | 3-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.