DPCstruct | MC47211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7YWU4 | 1-119 | MAYEIQADCASGGTLYAIVRTPAGQVWHPTGRAFEEWGAGGHGVGDYAIPLTDRGGSRYVGDFDGNIPDGTYCIQVFSQAGVDPADA… |
| A0A1F9B2S6 | 7-113 | ISTAWGETGITAYCIVRRGSDNYRLDDVDGSFAASPADPYLSLSEDSVLKGLYEVSENRTAWTDGRYLVAIYKQIGGSPAPASDAII… |
| A0A518B599 | 1-130 | None |
| A0A0F9WPY4 | 1-150 | None |
| A0A7C8EE04 | 1-118 | None |
| A0A0F9SQU7 | 1-110 | None |
| A0A0F9NIS1 | 15-129 | None |
| A0A518AZ40 | 1-131 | None |
| L0DGA0 | 6-120 | None |
| A0A402D734 | 24-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.