DPCstruct | MC4721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 293 |
|---|---|
| Mean domain length (aa) | 316 ± 57 aa |
| Standard deviation of domain lengths | 57.39 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 12.25 |
| Pfam Score | 75.38 |
| Assigned Pfam label(s) | PF16026- CL0376- PF04859 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9HKG2 | 27-309 | AIKSKFLEERQRCLVLEKDLFKSQTEGRRLMQQNKNLQDLNTLNAKNRNNTSSAFTLPSEFKSHWDELVKELILDAFPDFLDRYEEL… |
| A0A428T2I4 | 110-449 | EKSKKKQEELETNIRDMALSHQRVIDEMTAEHEAEITRRDAEAKSLEERFRAKLRADTTRLQNELTAAHKRMASYSNMDDYVATPDD… |
| M1WDI8 | 7-277 | None |
| A0A2K6VIQ4 | 12-235 | None |
| A0A1M3T3I8 | 674-1017 | None |
| A0A4S8MXA5 | 42-376 | None |
| A0A4S2N3C5 | 277-569 | None |
| A0A167XGU7 | 150-494 | None |
| A0A7M5V8B5 | 89-371 | None |
| A0A6G1J160 | 32-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.