DPCstruct | MC47209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 249 ± 41 aa |
| Standard deviation of domain lengths | 40.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7J009 | 53-264 | AQVSFSLQRDGIHPDPTGHWLMAQTLLTAWKAPNAAGGVQIDAGRGTVLAGQVTNLKKEGPGLFFEWQSPLPMPMDPKWDAESIRIE… |
| A0A6C9G4P9 | 2-236 | MAYLFLKAQGFVGKEVADVEINANKKQAVKSENCTISNIKKSGKDLSFDYLAGALPYPLDTIPRGWGQKKSQAEVLKVVPFMEEMNR… |
| A0A3L7UPF4 | 13-213 | None |
| A0A257VQW1 | 2-277 | None |
| A0A7X7IWK5 | 1-177 | None |
| A0A4P5YQ65 | 692-974 | None |
| A0A7X7RNL5 | 51-349 | None |
| A0A386HSR0 | 24-266 | None |
| A0A839GNM7 | 170-457 | None |
| A0A353ZAL3 | 346-581 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.