DPCstruct | MC47208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 141 ± 19 aa |
| Standard deviation of domain lengths | 18.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9LW49 | 55-185 | MADRVSAHILIGGTLSRGKYPALVQAISNDNPAIDWDGTPFDPTNIPANAPLALMDHEVAWGRFEAIEACCHRLGLHYVRWSNGYIG… |
| A0A7X7FTY5 | 1-128 | MGDRCYLEITLRRADLDRFGQHLDAAPGEEWWDHLDEEDNQPNIVTASVYEANYAWLDQRLAAAKEGIDFHGWHAEGGEYGPYEFVS… |
| A0A847YTP8 | 2-142 | None |
| A0A562K857 | 1-132 | None |
| A0A1D8AFH0 | 1-139 | None |
| T0HDT3 | 1-137 | None |
| A0A4P6XEP3 | 25-159 | None |
| A0A6I1K2Y6 | 1-127 | None |
| A0A2S7K003 | 1-142 | None |
| A0A1C4S6E6 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.