DPCstruct | MC47205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Standard deviation of domain lengths | 9.82 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 36.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09000 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A483ADQ8 | 211-280 | TSLKLGKKTSIQGGGRFRERYKDKKGNIYEWDSRHGTLEKYNKRGKHLGKYDSKIGKQLKPANKTRKVEP |
| A0A2N1NB33 | 76-144 | LSSVWKSFDSFRGKTKTSGTGKNKKYFEWDFTHNDIEVYDNKGNHLGSMDPSNGNMTKPPVKGRKINIS |
| A0A7L5ZC56 | 8-80 | None |
| A0A511MDX4 | 424-497 | None |
| A0A6I6A8I6 | 10-92 | None |
| A0A0U1HYN3 | 167-243 | None |
| A0A483A981 | 158-241 | None |
| A0A7T5FQK6 | 5-73 | None |
| W7BMD3 | 2-83 | None |
| A0A1A5XMG0 | 190-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.