DPCstruct | MC47203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 56 ± 1 aa |
| Standard deviation of domain lengths | 0.87 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 49.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482ZYN2 | 3-56 | MMLRYSLNQVNLAEKIEAAVNRVLDQGYRTEDIASEGSTVVGTNKMGDLVVAAL |
| A0A645FSW8 | 1-57 | MMLRFSLGQEAAALKIEAAVQKVLADGLRTADIYSEGTTKVSTREMGDAVVKALAEV |
| A0A520IFM5 | 194-249 | None |
| A0A1P8UUY5 | 5-60 | None |
| A0A103YL84 | 124-178 | None |
| A0A6L5FHT3 | 6-60 | None |
| A0A444E1Q1 | 188-242 | None |
| A0A7J0GM40 | 595-650 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.