DPCstruct | MC4720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 13.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428SXG3 | 21-139 | EPVWALDTEDKKPTTSAVGMAIHRPEGARNYILRAFAPPEAGVKKTVAAANEEKHEQLGRVLGALRLLFASWADTLSRDDLDRRAWS… |
| A0A7C8U5W2 | 224-322 | SQPPTASKLNPSALPIHLPHAAHSYLTRSFSQDKLPLLLGALHLLYESWVNALDAVDLDRKGWSWYCNIRPTVEDGPEGWGGKGLVK… |
| H0EE98 | 901-1026 | None |
| A0A544ZXJ6 | 368-488 | None |
| A0A2S4KRR3 | 387-506 | None |
| A0A1L9TNU9 | 115-235 | None |
| A0A4Z1PHA5 | 260-396 | None |
| A0A094FY33 | 184-309 | None |
| A0A447C9C9 | 548-695 | None |
| A0A0A2VJX1 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.