DPCstruct | MC472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 241 ± 44 aa |
| Standard deviation of domain lengths | 43.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A3IKA8 | 26-267 | EETKEEQVIKEEIDLSSEAEQFRAFAIEQMEPFIADAEMLAGYVKEGKLEEAQKLYPLVHMYYERLQPAKASFAALDAKIDTPVLRK… |
| A0A520QFU3 | 24-337 | GCADDPEAAATLSVKGYVEAELDTLHAASVALQRAAPEPDADGWNARDDAEAVASMRREWARARAAYERIEGAIAVLFPHLDVSTDE… |
| A0A6I5WP56 | 4-198 | None |
| A0A538TGT8 | 266-485 | None |
| A0A1N6JNI8 | 9-232 | None |
| A0A5B1LDT4 | 56-323 | None |
| A0A378W3T1 | 14-231 | None |
| A0A378F898 | 131-363 | None |
| A0A4U0Q6Z4 | 374-618 | None |
| A0A358JLQ9 | 24-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.