DPCstruct | MC47198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 14.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6PUC5 | 341-474 | VVAQVTKTGYVYVLDRETGEPLFPVVERPVPASDVPGEQAWPTQPIPVKPPPFVRTAFNENDISDLSPETRAAVKKEFDTLRSGTGF… |
| A0A1W9F3F3 | 1-169 | MPVIYVPTKTGNIFVLNRTNGELVVPAPEKPVPQGPAKGDRLSPTQPFSELTFRPEKKLTGADMWGATIYDQLVCRVMFHSLRYEGT… |
| A0A7W9SVK3 | 962-1097 | None |
| A0A4U9TR01 | 2-106 | None |
| A0A4U9D240 | 492-613 | None |
| A0A7G8BFS9 | 297-424 | None |
| A0A2V7Y9V5 | 319-436 | None |
| A0A484YLR3 | 2-97 | None |
| Q025P1 | 844-966 | None |
| A0A7V9NG03 | 348-469 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.