DPCstruct | MC47197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 97 ± 5 aa |
| Standard deviation of domain lengths | 5.04 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6R1T6 | 29-125 | GMIVDNPATLVQLGDFSKPEVLVGVLGLFLAFTLYAYRIKAAFIISIALTSIVAWTMGIGTLPKEFFSMPASIEPILFKLDVLSALS… |
| A0A1W9F2E6 | 1-105 | MVANPDTLVTIGSLTSHNVLLGALGFFIIAVLSSRNFHAAVLVSIVVTTLIGWMLGDVKYGGLFSLPPSITSVVGQVDVAGALDIGL… |
| A0A3S4U7H6 | 5-98 | None |
| A0A377MC64 | 1-99 | None |
| A0A7V8JKY7 | 65-150 | None |
| A0A377E173 | 9-112 | None |
| T1CDN4 | 4-102 | None |
| A0A6L7E639 | 12-111 | None |
| A0A6M1CJ63 | 57-152 | None |
| A0A484ZQF9 | 3-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.