DPCstruct | MC47195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 173 ± 30 aa |
| Standard deviation of domain lengths | 30.48 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05947 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M5EDC7 | 1-159 | MTLWPLEVAQADYFGNPAAVLGRLAASEPRAKAGLRIRLRSGAGIPFDSLSLDALPLYLHGADEQPYRLYEQLLGNACAVFVRAPDN… |
| A0A1W9F0S0 | 21-230 | VPRGTMMDSQTLKKSGITCSYTTAHDVTLQPVRIAGVELGGIPADIPLASLGLQHSGCVSALRIRLECYESVTLNNLQLDQLMFYLA… |
| A0A376UGC7 | 19-161 | None |
| A0A2T5R345 | 296-478 | None |
| G1Y226 | 99-288 | None |
| A0A6I1IQQ1 | 14-136 | None |
| A0A349KZ18 | 9-252 | None |
| A0A4U1HYM3 | 222-414 | None |
| A0A090RV07 | 4-158 | None |
| A0A2N7VTT0 | 182-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.