DPCstruct | MC47185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 411 ± 84 aa |
| Standard deviation of domain lengths | 83.98 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.88 |
| Pfam Score | 76.81 |
| Assigned Pfam label(s) | PF06772- PF06736 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843G9I8 | 1-371 | MNTNRFEKFFDAVLAIIITVLVLKLTQPTSPTLGAVLALNARFITYAICFLVIFIIWYDNHNLFQIVKEIDHKVLSIYAVQIFAISL… |
| A0A3D8T270 | 72-528 | YFIRRPRALQYFQDGNYVETLPSRHDSHQSEEAEPPEPNSSMWLRSRHRVPTALIPLPDGTDTRNTEEPILQRKRIDLFIDLLWVGI… |
| A0A6A6YTJ0 | 9-525 | None |
| A0A6G0X9F1 | 11-322 | None |
| A0A7M7ND24 | 45-560 | None |
| A0A1V9Z372 | 55-405 | None |
| I1CF08 | 305-641 | None |
| A0A067C5T4 | 21-469 | None |
| A0A067CL33 | 379-765 | None |
| A0A1S8W8A2 | 222-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.