DPCstruct | MC47184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 143 ± 32 aa |
| Standard deviation of domain lengths | 31.93 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12550 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D8T1G1 | 16-140 | VPAPAPGLAPKSAPGPVPVPVPEPVHGPPVFTALAKAFTVKDVWREWKEGIAGQPAIQELEETWESRWRPGNIVRVQFCRRKIIWDE… |
| B6QPT2 | 3-98 | SYQLSRTIQTVRELWTEWAIGLDGQPAVRIIEEQYGARWRADSKERVMFGRRKIIIDEIYARTRDGISLNKAIEAVELIQSKAHCTL… |
| A0A0C3GT83 | 101-204 | None |
| A0A0C3GPX7 | 65-188 | None |
| Q2HBP6 | 868-1007 | None |
| Q2H632 | 556-798 | None |
| Q2GMS0 | 1144-1264 | None |
| I2H019 | 217-316 | None |
| V9DSC1 | 185-296 | None |
| A0A0J9W3Z8 | 161-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.