DPCstruct | MC4718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 564 ± 28 aa |
| Standard deviation of domain lengths | 27.99 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 73.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8Q7K2 | 3-545 | RAAEAGLSVKGLRVKTFRPGEDEGSIEMSLVDDQNAAPVLNLNLLVSDPSDYPKGHSFFSYCPDGGPPDLFRDILDDLATAPSRPIA… |
| A0A428SVM3 | 1-580 | MGLKQFNLDLRAATSSYDDPHVTNVRKGDSDGEIVFTYVLEGQPPLDIQALSTDADSYPRHSSFLIFTSSDHATKDMDKWLQDFAAL… |
| A0A059J4J5 | 1-584 | None |
| A0A1S8A7C5 | 5-593 | None |
| A0A194S2S2 | 131-641 | None |
| A0A1M2V4S8 | 1-577 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.