DPCstruct | MC47175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 182 ± 10 aa |
| Standard deviation of domain lengths | 10.02 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 69.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821I2X8 | 1-205 | IVNYLIYLYFQSPLQARTAFGTYLQRIQFRLMLDSELKEDVTSSQHMELVIRFLKRAGQNLSPPFRVEIPSRRLCQSDQKRILAKEL… |
| O70505 | 109-292 | SKVQARLAFSAYLQHVQVRLTKDSGGQTLSPSWAAKEDEQMELVVRFLKRASSNLQHSLRMVLPSRRLALLERRRILAHQLGDFIVV… |
| A0A3P9D1I1 | 64-242 | None |
| A0A3Q4ACC7 | 51-239 | None |
| A0A1I8H6Z1 | 235-431 | None |
| A0A7M5VEK0 | 642-831 | None |
| H3BCN4 | 640-815 | None |
| A0A6P8RNZ2 | 563-737 | None |
| A0A6I9XSH2 | 433-616 | None |
| A0A3P9LV84 | 84-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.