DPCstruct | MC47173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 195 ± 21 aa |
| Standard deviation of domain lengths | 20.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 43.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14988 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821HUG3 | 14-204 | QELNNLQTLKEQLKKQATSILSDKEMNDLLMKEKIEEVQKKNKLIKELKEKVQCLELSLTKFIEEFDNERKKLLEQSQIEQESSHNE… |
| A0A212CTP1 | 59-252 | KEIGMVQTELKTIKQFQKRKIQVEKELDDEINDLLVKEKIMQLTQQRLQIQTLQKKVVSLENALVCMTKEFETEVLKLQQQAMVENQ… |
| A0A3Q2Q7C8 | 198-414 | None |
| A0A3B4ZYB3 | 124-323 | None |
| A0A6J0YLC2 | 211-396 | None |
| A0A672GBD2 | 131-321 | None |
| A0A813VPN1 | 3-192 | None |
| A0A3B4ABN7 | 166-397 | None |
| A0A437C3I9 | 3-228 | None |
| G3HNI3 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.