DPCstruct | MC4717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 172 ± 22 aa |
| Standard deviation of domain lengths | 21.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365N9G8 | 3-186 | PKALARSINDETVNIHAIGVDVCEKIPHRHIIPIKIHQLYEAIAADILYSVGIQKHEAEAPFKAICERIDSTKPLRYSKLDDYEGMN… |
| A0A428NK55 | 1-197 | MSDDLELARQFATEHMSHVLSALRREPMDLSAIALERSPILPIGFLTKTQQFNIQKAIVERIFMAVGENWDTAEEGLRYCIHVLERE… |
| A0A366PY19 | 1-195 | None |
| A0A2T3Z0S0 | 30-193 | None |
| A0A2T4BNG4 | 25-159 | None |
| A0A2H2YZB3 | 1-122 | None |
| A0A2K0UU44 | 1-195 | None |
| G9N1A6 | 111-270 | None |
| S0DMD6 | 16-196 | None |
| G9MDV1 | 11-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.