DPCstruct | MC47166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 134 ± 28 aa |
| Standard deviation of domain lengths | 27.54 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5AN90 | 8-135 | RAPAGGPALANFDAFLSALREPDTAAPVLSARRYVAALNIDLQTLADQAHVHRNTVARAPQSASVQQFLREAIRVIRAATDLSGDVQ… |
| A0A2R3J5L2 | 2-101 | FSPERFLKVFSMDQQTLAHRAHVHRNTVRNAPESEKVQAYIRDSVKVLRAVTDMGTDVTNAIFWFKNEPLSTFNYKTAEEVVSEGKT… |
| H0I201 | 15-131 | None |
| A0A560HXP4 | 1-120 | None |
| A0A2V5VY87 | 1-188 | None |
| A0A0A0F1F8 | 1-157 | None |
| R7Q7I8 | 70-218 | None |
| A0A7X4G651 | 24-129 | None |
| A0A402CZX6 | 150-277 | None |
| W0J9D4 | 82-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.