DPCstruct | MC4716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 76 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A679NGU1 | 6-73 | VRKVTETIRSDHTQWQCSSCQTLNSMTEEICSNCSRSRVGQSLAVTAGGEIIGGNAGKNSAGKEEWYY |
| A0A428SMS4 | 2-74 | VKQKEIRDDHKKWRCMQMFRTEVRCYRYNDMDIKQCANCKAKRDAGDEAINANLDKIGKLDRVEKDGTECYFQ |
| A0A420PEV0 | 10-106 | None |
| A0A395SR59 | 135-208 | None |
| A0A420PVV9 | 5-76 | None |
| A0A428PYW8 | 171-247 | None |
| A0A420SNB0 | 41-113 | None |
| A0A1B8AG94 | 58-133 | None |
| W9QJ06 | 1-89 | None |
| A0A5Q3FII8 | 179-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.