DPCstruct | MC47149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 162 ± 22 aa |
| Standard deviation of domain lengths | 22.06 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X5DD53 | 3-162 | KLPGNLYHLFYDELPPERYDSIIPPREAWREVCRHYVLDSGRSGGFNMFGDDIQPRSPWDTQTVIETGRYANKLKGDIECGNIVYID… |
| A0A5J5FW70 | 3-129 | LVDLRCEKLSLEKYDHILSPAHARRLLSQEFVLVHAPANNFFPVPGYQLRSRTGFCSHNQPSADITPLLKLIDTGEVVVVDEHGSWN… |
| A0A7R8RGL7 | 4-187 | None |
| A0A2K1Q5Q2 | 1-179 | None |
| Q665T8 | 4-162 | None |
| L0M6B2 | 4-146 | None |
| A0A0E1NXK9 | 4-167 | None |
| V3P3L1 | 4-181 | None |
| A0A0E8XP13 | 4-165 | None |
| A0A0T9R3S7 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.