DPCstruct | MC47145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 131 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 13.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06903 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832BRN7 | 15-156 | GCASQKQSQQMPYWQLVFQNDFNGNTLSGSKQELSDALKRGSPIRVSWGEKLADGTSCVEFAVPDFTTLMNDSDVVVQFPMSLIQTN… |
| A0A2E7D3V5 | 125-252 | WRVVYEHDAEGNCVAGDLDELKEHIRAGRSIKVGVRQLFGIQDDDLSGPEHISFLDIMQPLIKDGHVGANCDFILAGAPKWPFTWEN… |
| A0A2N3AE82 | 15-159 | None |
| A0A3S1B8M3 | 401-550 | None |
| A0A7R8XAN6 | 153-279 | None |
| A0A5E4YSX9 | 131-251 | None |
| A0A7X8QT04 | 1-123 | None |
| A0A7D9MFA7 | 100-214 | None |
| A0A7R9FNT7 | 472-597 | None |
| A0A1W6YYJ6 | 69-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.