DPCstruct | MC4714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 116 ± 20 aa |
| Standard deviation of domain lengths | 19.83 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0RLW4 | 2-121 | LYWGEGGKTHHGMARVSNCDPAIIKVMMRFFREICHVPEEKFRAYIHTYSHLSASEAEQYWSKVTSIPRRQFYKTYVKASVSSQGKR… |
| A0A2H9NSU8 | 66-177 | DDLFFEALGLWQGEGGKNKGLYFGNSCLELILHFLEFTRQKLGIKRDEFKVTMNTPEKFESENFVKNMYSEEMGIPLENFTNVCVDK… |
| A0A7J9YQU3 | 2-99 | None |
| A0A7M3MQV2 | 71-213 | None |
| A0A1F5X289 | 43-181 | None |
| A0A1F6CHR3 | 87-224 | None |
| A0A7W3LZQ7 | 132-240 | None |
| A0A7C4L3U5 | 13-134 | None |
| A0A497FEU7 | 9-108 | None |
| A0A7W3R8Q2 | 37-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.