DPCstruct | MC47138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 385 ± 67 aa |
| Standard deviation of domain lengths | 67.33 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287I405 | 3-411 | VRKQVSNPDMKYKRMGIIGALRIVSTIADANAAVNCSSSQQPNCEEALGLLNMTVNSCKFVTLPLILLYDELSALFESSVLHSAIIE… |
| A0A6J1W244 | 348-698 | IQGHRNSHIQDDMHVVIRKQLSSTIPKYKRIGIIGAVTMVGSMAAKRSKENGKLLEREQLTKEQHREIITLLELVFSCCGQDPHALA… |
| A0A7J7IIQ4 | 1-350 | None |
| A0A453BMG9 | 2-511 | None |
| A0A821LQX5 | 7-370 | None |
| A0A7R9CUH4 | 368-684 | None |
| A0A4Z2B9Z8 | 2-306 | None |
| A0A177WJ38 | 4-375 | None |
| A0A1R1Y8M7 | 13-336 | None |
| A0A388KF27 | 14-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.